AnaSpec Introduces Fifty-Five New Catalog Peptides
(
PRLEAP.COM) August 31, 2007 – San Jose, CA - Today AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced fifty-five (55) new peptides for drug discovery research.
Beta-Amyloid (1-11)-Lys (Biotin) - Cat# 62135
This is a C-terminal Lys(Biotin) modified b-Amyloid peptide; residues 1 to 11.
Sequence: DAEFRHDSGY-K(Biotin)
Beta-Amyloid (1-17)-Lys(Biotin-LC) - Cat# 62136
This is a C-terminal Lys(Biotin-LC) modified b-Amyloid peptide; residues 1 to 17. 6-aminohexanoate (LC) is used as a spacer.
Sequence: DAEFRHDSGYEVHHQK-K(BIOTIN-LC)-NH2
[Gly10;11]-beta-Amyloid (1-11) - Cat# 62138
This N-terminal fragment of b-Amyloid peptide; residues 1 to 11; has been modified with two glycines at positions 10 and 11 instead of Tyr (Y) and Glu (E).
Sequence: DAEFRHDSGGG
Beta-Amyloid (16-24) - Cat# 62139
Sequence: KLVFFAEDV
[Gly11;12] -beta-Amyloid (1-13)-Lys(Biotin) - Cat# 62134
This is the N-terminal fragment of the b-Amyloid peptide; residues 1 to 13; modified with two glycines substituted for Glu (E) and Val (V) at positions 11 and 12 and Lys(Biotin) coupled to the C-terminus.
Sequence: DAEFRHDSGYGG-K(BIOTIN)
TAT-NSF222scr Fusion Polypeptide; scrambled - Cat# 62210
This is a scrambled TAT-NSF222scr fusion polypeptide. It is composed of 11 amino acids from the cell permeable human immunodeficiency virus TAT polypeptide; 3 glycines as a linker; followed by scrambled N-Ethyl-maleimide-sensitive factor (NSF) D1 domain. This peptide is used as a control for the TAT-NSF222 peptide.
Sequence: YGRKKRRQRRR-GGG-ENSFRFLADIFPAKAFPVRFE
GLP-2 (1-34); Glucagon-ike Peptide-2 (1-34); human - Cat# 62068
Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability; and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor; a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
C34-LC-Biotin; gp41 HIV fragment - Cat# 62103
This peptide C34; also known as HR2; belongs to the helical region of gp41 of HIV; C-terminal heptad repeat 2 (HR2) defined as C helix or C-peptide. This peptide is biotinylated through 6-aminohexanoate (LC) as a spacer. HIV-1 enters cells by membrane fusion; gp41. C-peptides are potent inhibitors of HIV-1 fusion.
Sequence: WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLK(LC-Biotin)
3;4 Dehydro-Pro-Arg-Vasotocin - Cat# 62097
This is a neurohypophyseal nonapeptide hormone showing both vasopressin- and oxytocin-like activities.
Sequence: CYIQNC(3;4-Dehydro-pro)-RG-NH2 (S-S Bond)
MBP p68–86; Myelin Basic Protein p68–86 - Cat# 62081
This is a myelin basic protein encephalitogenic epitope used to induce experimental autoimmune encephalomyelitis (EAE) in rats.
Sequence: YGSLPQKSQRSQDENPV
?-C2/V1 (49-53); ? PKC; C2 Domain (49-53) - Cat# 62175
This peptide belongs to the C2 regulatory domain of ?-protein kinase C; also known as ?-PKC/V1. This peptide; used in studying the physiological role of isozymes; is most likely the PKC-selective activator and is found to be cardioprotective.
Sequence: SRIGQ
?-C2/V1; ? PKC; C2 Domain (119-124) - Cat# 62177
This peptide belongs to the C2 regulatory domain also called VI of ?-protein kinase C (?-PKC). This ?-C2/V1 peptide may act as inhibitor of PKC translocation; this inhibitory activity results in decline of MARCKS phosphorylation.
Sequence: LEPEGK
CLP24 (187-201); Claudin-like Protein 24 (187-201); human - Cat# 62172
This peptide is a hypoxically regulated cell junction protein fragment. The claudin-like protein 24 (CLP24) contains four predicted trans-membrane domains and a C-terminal protein-protein interaction domain. These domains are characteristic of the four trans-membrane spanning family of proteins; which includes myelin protein 22. These proteins are involved in cell adhesion at tight; gap and adherens junctions. CLP24 is highly expressed in lung; heart; kidney and placental tissues.
Sequence: IWNILHKREDCMAPR
Gamma-Fibrinogen (377-395) - Cat# 62128
This fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). Fibrinogen is a regulator of microglia activation and interaction of fibrinogen with the microglia integrin receptor Mac-1. Because blocking fibrinogen–Mac-1 interactions affects the pro-inflammatory but not the pro-coagulant properties of fibrinogen; targeting this gamma- fibrinogen epitope could represent a potential therapeutic strategy for MS and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation.
Sequence: YSMKETTMKIIPFNRLSIG
Gamma-Fibrinogen (377-395); scrambled - Cat# 62129
This is a scrambled sequence of the g-fibrinogen amino acids 377 to 395. The original fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). This scrambled peptide fails to produce these functions.
Sequence: KMMISYTFPIERTGLISNK
Glu-Glu epitope Tag - Cat# 62189
This peptide is a 314 to 319 amino acids fragment of the middle T antigen of mouse polymavirus. Glu-Glu epitope peptide is widely used as an epitope tag.
Sequence: EYMPME
Pro-apoptotic Peptide; klaklakklaklak; 5/6-FAM-labeled - Cat# 62206
This is the pro-apoptotic peptide composed of D-amino acids; 5-FAM labeled. This alpha-helical amphipathic peptide is toxic to eukaryotic cells if internalized by a suitable targeting mechanism. It disrupts mitochondrial membranes upon receptor-mediated cell internalization and causes programmed cell death.
Sequence: 5-FAM-klaklakklaklak-NH2
Beta-Amyloid (1-17) - Cat# 61955
This is beta-Amyloid peptide fragment derived from amino acids 1 to 17. This peptide was employed in the b-Amyloid solubility studies.
Sequence: DAEFRHDSGYEVHHQKL
Beta-Amyloid (1-9) - Cat# 61970
This is the N-terminal fragment of b-Amyloid peptide amino acids 1 to 9. Omission of residues 1 to 9 from the full-length Alzheimer’s b-Amyloid peptide 1 to 40 does not prevent the peptide from forming amyloid fibrils or eliminate fibril polymorphism. This b-Amyloid peptide fragment contains a functional B cell epitope; but lacks known T cell epitopes; which makes it an attractive candidate for the development of b-Amyloid vaccine that lacks the potential to induce autoimmune encephalitis.
Sequence: DAEFRHDSG
Beta-Amyloid (25-35); Scrambled - Cat# 61971
This is the scrambled beta-Amyloid peptide amino acids 25 to 35. Pairing this peptide with the native b-Amyloid 25 to 35 amino acids peptide has been used to recognize its structure and functions.
Sequence: MAKGINGISGL
Beta-Amyloid (22-42) - Cat# 61972
This is the hydrophobic C-terminal fragment of b-Amyloid peptide amino acids 22 to 42.
Sequence: EDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (1-9)-Lys(Biotin-LC)-NH2 - Cat# 61973
This is an N-terminal modified fragment of the b-Amyloid 1 to 9; with the addition of a lysine and a biotin conjugated to a spacer; 6-aminohexanoate (LC).
Sequence: DAEFRHDSG-K(Biotin-LC)-NH2
Beta-Amyloid (8-40) - Cat# 61975
This peptide is b-Amyloid 8 to 40 amino acids fragment. Angiotensin-converting enzyme (ACE) genotype has been shown to be associated with Alzheimer’s disease (AD) in some populations. ACE degrades b-Amyloid by cleaving ß-?Amyloid 1 to 40 between Asp7-Ser8. Compared with b-Amyloid 1 to 40; aggregation and cytotoxic effects of the degradation products b-Amyloid 1 to 7 and b-Amyloid 8 to 40 peptides are reduced or virtually absent.
Sequence: SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Beta-Amyloid (30–34) - Cat# 61977
This peptide is beta-Amyloid 30 to 34 amino acids fragment. The structural fluctuations of amyloid peptides were analyzed for the presence of flickering of alpha-like and ß-like structure. The flickering of alpha-helical structure was apparent in the AIIGL (30–34) region. This peptide has a strong helical propensity.
Sequence: AIIGL
Beta-Amyloid (17–24) - Cat# 61978
This peptide is b-Amyloid 17 to 24 amino acids fragment. Several lines of evidence indicate that a region centering around positions 17 to 20 amino acids is important for b-Amyloid fibril formation. Destabilization of a helix covering residues 11–24; in particular residues 17–24; is critical for alpha-helix to b-strand conversion and fibril formation.
Sequence: LVFFAEDV
[Cys3]-beta-Amyloid (4-10) - Cat# 61979
This peptide is b-Amyloid 4 to 10 amino acids fragment. b-Amyloid (4-10) is the predominant B-cell epitope recognized by therapeutically active antisera from transgenic Alzheimer’s disease mice. Cysteine residue is added for the use in antibody development.
Sequence: CFRHDSGY
Beta-Amyloid (35-42) - Cat# 61981
This synthetic peptide corresponding to amino acids 35 to 42 of b-Amyloid protein; is widely used as an immunogen for the development of the anti- b-Amyloid antibodies.
Sequence: MVGGVVIA
Beta-Amyloid (33-40) - Cat# 61982
This is a synthetic peptide fragment corresponding to amino acids 18 to 25 of b-Amyloid; and amino acid residues 704 to 711 of amyloid precursor protein (APP). This peptide is widely used as an immunogen for anti- b-Amyloidantibodies development.
Sequence: GLMVGGVV
Amyloid Precursor Protein (APP) (44-62) - Cat# 61983
This is a synthetic peptide corresponding to N terminal amino acids 44 to 62 of human amyloid precursor protein (APP).
Sequence: HMNVQNGKWDSDPSGTKTC
[Phe34]-beta-Amyloid (25-35) - Cat# 61984
This is a modified fragment of the b-Amyloid peptide amino acids 25 to 35 with leucine at the position 34 replaced by phenylalanine.
Sequence: GSNKGAIIGFM
Beta-Amyloid (26-40) - Cat# 61985
This is a fragment of the b-Amyloid peptide amino acid residues 26 to 40; the same sequence belongs to the amyloid precursor protein695 (APP695) amino acids 622 to 637; a linear peptide which contains the GVV terminal sequence of ß-?Amyloid (1–40).
Sequence: SNKGAIIGLMVGGVV
Beta-Amyloid (20-42) - Cat# 61989
This synthetic peptide corresponds to amino acids 20 to 42 of b-Amyloid protein.
Sequence: FAEDVGSNKGAIIGLMVGGVVIA
[Met-1;Leu35]-beta-Amyloid (1-42) - Cat# 61957-01
This is the beta-Amyloid peptide amino acid residues 1 to 42 modification. Methionine is coupled to the N-terminus at position-1; and leucine replaces methionine at position 35.
Sequence: MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLLVGGVVIA
Beta-Amyloid (17-24); biotinylated - Cat# 61980
This is a biotinylated form of b-Amyloid (17-24). The synthetic peptide corresponding to amino acids 17 to 24 of b-Amyloid protein is the putative sequence responsible for hepatic b-Amyloid 1 to 40 uptake by the liver; which plays a major role in the systemic clearance of b-Amyloid 1 to 40.
Sequence: BIOTIN-LVFFAEDV
Nociceptin (1-13); amide - Cat# 61950-5
This 1 to 13 amino acid fragment of the nociceptin agonist is the smallest peptide with the potency of the natural nociceptin protein. Nociceptin is related to opioid peptides.
Sequence: FGGFTGARKSARK
M2 (127-135); Respiratory Syncytial Virus (RSV)-specific peptide (127-135) - Cat# 62021
This is an optimal nine-amino-acid 127 to 135 peptide respiratory syncytial virus (RSV)-specific; the H-2Kd-restricted subdominant epitope in the M2 protein; which contains an H-2Kd consensus sequence with Y at position 2 and I at position 9. The M2 gene is unique to the genus Pneumovirus. It has two overlapping open reading frames; M2-1 and M2-2; both involved in the viral RNA synthesis process.
Sequence: VYNTVISYI
NPSF (1-37); Neuropeptide SF (1-37) - Cat# 62016
This sequence is a mature Neuropeptide SF (NPSF) peptide derived from the neuropeptide precursor. NPFF gene encodes for three peptides: NPFF; NPAF; and NPSF. This peptide belongs to the family of neuropeptides that function as neurotransmitters and neuromodulators.
Sequence: SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH2
NPVF - Cat# 62006
This sequence is a neuropeptide encoded by the NPVF gene. The NPVF-is the endogenous ligand for FF1 receptor. NPVF mRNA was detected specifically in a region between the dorsomedial and ventromedial hypothalamic nuclei. Following intracerebral administration; NPVF-derived peptide blocks morphine-induced analgesia in both acute and inflammatory models of pain. The NPVF/FF1 system may be an important part of endogenous anti-opioid mechanism.
Sequence: VPNLPQRF-NH2
TIF2 (740-753); Transcriptional Intermediary Factor 2 (740-753) - Cat# 61992
This peptide is a nuclear receptor (NR) box B3 region of the p160 co-activator Transcriptional Intermediary Factor 2 (TIF2) peptide; a LXXLL motif. The activation function 2/ligand-dependent interaction between nuclear receptors and their co-regulators is mediated by a short consensus motif nuclear receptor box.
Sequence: KENALLRYLLDKDD
RIP (817-828); Receptor Interacting Protein (817-828) - Cat# 61996
This sequence corresponds to the LXXLL motif derived from the 140 kDa Receptor Interacting Protein (RIP140) amino acids 498 to 509. LXXLL motif is a signature sequence that facilitates the interaction of different proteins with nuclear receptors.
Sequence: GLLSRLLRQNQD
SRC 1 (1433-1441); Steroid Receptor Co-activator 1 (1433-1441) - Cat# 61999
This short sequence present in Steroid Receptor Co-activator 1 (SRC1) is necessary and sufficient to mediate the binding of the protein to liganded nuclear receptors. An alpha-helical motif containing the sequence LXXLL (where L is leucine and X is any amino acid) is required for the ligand-dependent binding of transcriptional co-activators to nuclear receptors.
Sequence: SLLQQLLTE
TIF2 (682-700) box 2; Transcriptional Intermediary Factor 2 (682-700); Box2 - Cat# 62000
This is a Nuclear Receptor (NR)-box peptide 2; also known as Transcriptional Intermediary Factor 2 (TIF2) box 2; amino acids 682 to 700; the potent competitor of the TR LBD (Thyroid Hormone Ligand Binding Domain ) / NID3 (NR Interaction Domain) interaction; it is also sufficient to interact with TR-beta LBD.
Sequence: TSLKEKHKILHRLLQDSS
TIF2 (636-649); Transcriptional Intermediary Factor 2 (636-649); Box1 - Cat# 61993
This is LXXLL motif Box B1 of the Transcriptional Intermediary Factor 2 (TIF2) peptide; amino acids 636 to 649. The interaction studies between estrogen receptor (ER alpha ) and the nuclear receptor (NR) box regions of the p160 coactivator TIF2 showed that C-terminal ligand-binding domain (LBD) of ER binds LXXLL motifs (Box B1 and B3) and exhibits different binding kinetics compared with the Box B2 motif.
Sequence: KGQTKLLQLLTTKS
RIP (131-142); Receptor Interacting Protein (131-142). - Cat# 61995
This sequence corresponds to the LXXLL motif derived from the 140 kDa Receptor Interacting Protein (RIP140); amino acids 131 to 142. Ligand-dependent gene expression mediated by nuclear receptors involves the recruitment of transcriptional co-activator to the ligand binding domain (LBD). This motif shows strong binding to LBD.
Sequence: TLLASLLQSESS
RIP (498-509); Receptor Interacting Protein (498-509) - Cat# 61997
This sequence corresponds to the LXXLL motif derived from the 140kDa Receptor Interacting Protein (RIP140); amino acids 498 to 509.
Sequence: TLLQLLLGHKNE
SRC 1 (1433-1440); Steroid Receptor Co-activator (1433-1440) - Cat# 61998
This short sequence corresponding to the motif LXXLL (where L is leucine and X is any amino acid) of Steroid Receptor Co-activator (SRC1) is necessary and sufficient to mediate the binding of this protein to liganded nuclear receptor.
Sequence: SLLQQLLT
105Y; alpha1-antitrypsin (359-374) - Cat# 62004
This peptide representing the sequence of a candidate receptor-binding domain in the carboxyl-terminal tail of alpha1-antitrypsin (a1-AT) was shown to mediate increases in synthesis of alpha1-AT in human monocytes and human hepatoma HepG2 cells. The serpin-enzyme complex (SEC) receptor was originally identified using this peptide; 105Y.
Sequence: SIPPEVKFNKPFVYLI
EGFR (662-681) - Cat# 62013
This peptide belongs to epidermal growth factor receptor; (EGFR); amino acids 662 to 681. The epidermal growth factor receptor is a member of the ErbB family of receptors. This peptide was used in several assays; including determination of the p42/44 (ERK) MAP kinases activity.
Sequence: RRELVEPLTPSGEAPNQALLR
Hemoglobin; 3037a; Malaria FRET Substrate II - Cat# 62014
The sequence of this peptide is based on the primary site of cleavage within hemoglobin (Hb). The numbering of the peptide corresponds to the residues within the alpha-chain of Hb. This peptide was used to characterize the molecular mechanism underlying Hb degradation by plasmepsin II (PM II). N-terminal (GABA) extension results in higher maximal velocity and dramatic concentration-dependent substrate inhibition. Hb is degraded in the protozoan parasite Plasmodium falciparum. Of the four types of malaria infecting humans; the most severe form is caused by P. falciparum.
Sequence: DABCYL-GABA-ERMFLSFP-EDANS
Hemoglobin; 2837a; Malaria FRET substrate III - Cat# 62015
The sequence of this synthetic peptide is based on the primary site of cleavage within hemoglobin (Hb). The numbering of the peptide corresponds to the residues within the alpha-chain of Hb. Hb is degraded in the protozoan parasite Plasmodium falciparum. Of the four types of malaria infecting humans; the most severe form is caused by P. falciparum. To mature inside erythrocytes; parasites degrade vast amounts of Hb in an enormous catabolic effort. Plasmepsin II (PM II) is an aspartic protease that cleaves hemoglobin in the protozoan parasite P. falciparum. N-terminal (GABA) extension results in higher maximal velocity and dramatic concentration-dependent substrate inhibition.
Sequence: DABCYL-GABA-ALERMFLSFP-EDANS
PKC zeta 560 - Cat# 62020
This protein kinase C (PKC) zeta isoform contains the threonine 560 autophosphorylation site. The full activation of PKC-zeta by insulin in addition to other factors requires phosphatidylinosito (PIP3)- dependent enhancement of autophosphorylation of threonine 560.
Sequence: EPVQLTPDDEDA
Microtubule-associated Protein 7; MAP7; mouse (CT) - Cat# 61952
This peptide is a C-terminal fragment of microtubule-associated protein 7 (MAP7); the mouse transient receptor potential vanilloid 4 (TRPV4) C-terminal binding protein analog; and a member of the transient receptor potential family of ligand-gated ion channels. TRPV4 and MAP7 co-localize in the lung and kidney.
Sequence: TQQTAEVI
Microtubule-associated Protein 7 (MAP7); mouse (NT) - Cat# 61953
This peptide is N-terminal fragment of microtubule-associated protein 7 (MAP7); the mouse Transient Receptor Potential Vanilloid 4 (TRPV4) C-terminal binding protein analog; and a member of the TRPV family of ligand-gated ion channels.
Sequence: MDQAKSAE
Aquaporin 2 (241-271); AQP2 (241-271) - Cat# 62007
This sequence belongs to the aquaporin 2 (AQP2) residues 241 to 271. It is a vasopressin-regulated water channel. Studies reveal a reciprocal change in Ser256 and Ser261 phosphorylation in response to short-term vasopressin exposure; suggesting that these residues may serve distinct roles in regulation of AQP2 subcellular distribution and collecting duct water permeability.
Sequence: EPDTDWEEREVRRRQSVELHSPQSLPRGSKA
MKK4 Docking Site peptide - Cat# 62001
This sequence is a minimal MKK4 docking site; or ‘D-site’ peptide. MAPK-docking site is in the N terminus of human MKK4/JNKK1. This docking site is necessary for the high affinity binding of the MAPKs JNK1; JNK2; JNK3; p38-alpha; and p38-beta to MKK4. Specific docking interactions between MAPKs and their activating MAPK kinases (MKKs or MEKs) are crucial for efficient and accurate signal transmission.
Sequence: QGKRKALKLNF
Company Info
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and combinatorial chemistry. Established in 1993, AnaSpec’s headquarters and manufacturing facilities are located in San Jose, CA.
For more information visit
www.anaspec.com
Contact Information
About This News Release
If you have any questions regarding information in these press releases please contact the organization listed in the press release. Issuers of press releases and not PR Leap are solely responsible for the accuracy of the content.